SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7G505 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7G505
Domain Number 1 Region: 211-356
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.72e-31
Family AlaX-like 0.024
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily HSP20-like chaperones 9.84e-23
Family Co-chaperone p23-like 0.00019
Further Details:      
 
Domain Number 3 Region: 152-210
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000109
Family AlaX-M N-terminal domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7G505
Sequence length 522
Comment (tr|F7G505|F7G505_CALJA) PTGES3L-AARSD1 readthrough {ECO:0000313|Ensembl:ENSCJAP00000041971} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PTGES3L-AARSD1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKDSQDKRSSRSITCFV
RKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDEEVELAHVEHYAELLKKVSTKRPPP
AMDDLDFTTTVVSCRPAELQTEGSNGKKEVLSGFQVVLEDTLLFPEGGGQPDDHGTINDI
PVLKVTRRGEQADHFTQTPLEPGSQVLVQVDWERRFDHMQQHSGQHLITAVADHLFKLKT
TSWELGRFRSVIELDSPSVTAEQVAAIEQSVNEKIRDRLPVNVQELSLDDPEVEQVRGRG
LPDDHAGPIRVVTIKGVDSNMCCGTHVSNLSDLQVIKMLGTEKGKKNKTNLIFLAGNRVL
KWMGRSHGTEKALTALLKCGAEDHVEAVKKLQNSTKLLQKNNLSLLRDLAVHSAHRLRNS
PDWGGVVLLHSRDGDFAVLARLIGSEETLLFLTVGDEKGAGLFLLAGPPVAVETLGPRVA
EVLEGKGAGKKGRFQGKAMKMSRRPEAQALLQDYISTQSTKE
Download sequence
Identical sequences F7G505
ENSCJAP00000024027 ENSCJAP00000041971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]