SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7G5H7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7G5H7
Domain Number 1 Region: 195-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.06e-25
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 51-111
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 4 Region: 153-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7G5H7
Sequence length 297
Comment (tr|F7G5H7|F7G5H7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000010086} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MELLAPRSSTLETRLGKDGVASPDGLTGATPLLLYRKPGAPGMAFERDRFPAQEGLTFKD
VAVDFTREEWCLLSPPQKELYKEVMLENAQNLLSVGLPGPPEDVISYLKQRKDPWMLEQE
GLRSCCPGEGEEKRCRRKPGLDLTISKKFSKIHTDERHYECNHCGKTFTMNSYLAVHQRI
HTRAKPYECKQCGKTFTMNSNLSVHQRIHTGVKPYECKHCGKTFRSGSYLAVHQRIHTGE
KPYECKQCGKTFTDNSNLGRHQRIHTGAKPFECKECGKTFTMNSSLPRHQRVHTKEK
Download sequence
Identical sequences F7G5H7
ENSMODP00000010086 ENSMODP00000010086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]