SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7G5I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7G5I8
Domain Number 1 Region: 373-428
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000574
Family UBA domain 0.00031
Further Details:      
 
Domain Number 2 Region: 441-494
Classification Level Classification E-value
Superfamily UBA-like 0.00000397
Family UBA domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7G5I8
Sequence length 498
Comment (tr|F7G5I8|F7G5I8_MONDO) Ubiquitin associated protein 1 {ECO:0000313|Ensembl:ENSMODP00000010083} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=UBAP1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
GTFSYLDDVPFKIGDKFKTPAKVGLPIGFSLPDSLQAVRETQYDFSLERKTIEWAEDLKK
IQEAQREAEQKAEETEAKVNSKSGPEGDSNMGFSKTHCPTTMPPPINPILASLQHNNILT
PTRVSSSAIKQNVLSPPHTKADFNPADFECEEDPFDNMELKTIDEKEELRNILVGTTGPI
VAQILDNNLPKGGSGSVLQDQEVLASLERAALDFKPLHKPNGFITLPQLGNCEKMSLSSK
VSLPPVTAVSNIKSLSFPKLDSDDSEQKTAKLSSTFHSTTCLRNGTFLNSLKPCSQNNAS
ELNGYLGVGLSALNLDSGKETPALSPSSQLPSLSVLSVCTEESSPPNTVLTVMPHDVRTT
QVPNTPSCPPGSSTTPTYSDLQALSPSERQCVETVVNMGYSYDSVLKAMKKKGENIEQVL
DYLFAHGQLCEKGFDPILVEEALEMYQCSEEKTTEFLQLMSKFKEMGFELKDIKEVLLLH
NNDQDNALEDLMARAGAS
Download sequence
Identical sequences F7G5I8
ENSMODP00000010083 13616.ENSMODP00000010083 ENSMODP00000010083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]