SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7G6J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7G6J5
Domain Number 1 Region: 175-421
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.02e-86
Family Eukaryotic proteases 0.00000000863
Further Details:      
 
Domain Number 2 Region: 48-104
Classification Level Classification E-value
Superfamily GLA-domain 8.24e-21
Family GLA-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 96-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7G6J5
Sequence length 423
Comment (tr|F7G6J5|F7G6J5_MACMU) Coagulation factor IX {ECO:0000313|Ensembl:ENSMMUP00000026395} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=F9 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNL
ERECMEEKCNFEEAREVFENTEKTTEFWKQYVDVTCNIKNGRCKQFCKNTADNKVVCSCT
EGYRLAENQKSCEPAVPFPCGRVSVSQTSTLTRAETVFPDVEYVNSTEAETILDNITQST
QSFNDFTRVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIINEKWVVTAAHCVETDAKITVV
AGEHNIEETEHTEQKRNVIRIIPHHNYNATINKYNHDIALLELDEPLVLNSYVTPICIAD
KEYTNIFLKFGSGYVSGWGRVFNKGRSASVLQYLRVPLVDRATCLRSTKFTIYNNMFCAG
FHEGGRDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKT
KLT
Download sequence
Identical sequences F7G6J5
ENSMMUP00000026395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]