SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7G7Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7G7Y2
Domain Number 1 Region: 174-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000359
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 213-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000224
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 134-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000136
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 95-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000298
Family EGF-type module 0.0077
Further Details:      
 
Weak hits

Sequence:  F7G7Y2
Domain Number - Region: 64-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00286
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7G7Y2
Sequence length 383
Comment (tr|F7G7Y2|F7G7Y2_MACMU) Protein delta homolog 2 {ECO:0000313|EMBL:AFJ70361.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_14936 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERC
VRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCL
PGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLM
RPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPS
GYGGKTCELVLPVPHPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEA
GLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQV
SMLPAGLPLPPDLPPEPGKTTAL
Download sequence
Identical sequences A0A2K6BI66 F7G7Y2 G8F4F1
ENSMMUP00000020431 ENSMMUP00000020431 ENSMMUP00000033628 9544.ENSMMUP00000033628 NP_001253294.1.72884 XP_005552969.1.63531 XP_007970672.1.81039 XP_007970673.1.81039 XP_007970674.1.81039 XP_007970675.1.81039 XP_011752751.1.29376 XP_011752752.1.29376 XP_011752753.1.29376 XP_011752754.1.29376 XP_011752756.1.29376 XP_014991851.1.72884 XP_014991852.1.72884 XP_014991853.1.72884 XP_015304867.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]