SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7G979 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7G979
Domain Number - Region: 10-107
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0196
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7G979
Sequence length 252
Comment (tr|F7G979|F7G979_CALJA) Transient receptor potential cation channel subfamily V member 6 {ECO:0000313|Ensembl:ENSCJAP00000044536} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TRPV6 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFST
FELFLTIIDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELW
RAQIVATTVMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDLNRQRIQRYAQAFHT
RGSEDLDKDSVEKLELGCPFSPHLPLPTPSVSRSTSRSSANWERLRQGTLRRDLRGIINR
GLEDGEGWEYQI
Download sequence
Identical sequences F7G979
ENSCJAP00000044536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]