SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7G9E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7G9E9
Domain Number - Region: 36-93
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00132
Family Eukaryotic type KH-domain (KH-domain type I) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7G9E9
Sequence length 117
Comment (tr|F7G9E9|F7G9E9_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000018264} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=DPPA5 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGTLPERRNIPPWVKVPEDLKDPEVFQVQTRLLEAMFAGRDGCRIPYIEQVSKAMLELKA
LESPDFTEVVVYGSYIYKLRAKWMLQSMAEWHRQRQERGMLKLEEAMNALELSPWMN
Download sequence
Identical sequences F7G9E9
ENSCJAP00000018264 ENSCJAP00000018264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]