SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GAI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GAI6
Domain Number 1 Region: 384-710
Classification Level Classification E-value
Superfamily DNase I-like 1.57e-55
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000825
Further Details:      
 
Domain Number 2 Region: 3-102
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-27
Family SH2 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7GAI6
Sequence length 1095
Comment (tr|F7GAI6|F7GAI6_MONDO) Inositol polyphosphate-5-phosphatase D {ECO:0000313|Ensembl:ENSMODP00000028657} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=INPP5D OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MVHCWNHGNITRSKAEELLSKTGKDGSFLVRASESIPRAYALCVLYRTCVYTYRILPNEE
DKFTVQASEGVPVRFFTSLDQLIEFYKKENMGLVTHLQYPVPIEEEEAGDELEEETEFFL
SPPELPPRNLPLSSGASEAKEVLPPDNSRVMEPSKLSLSETLLQRFQGMDTSGLPEEHLK
AIQDYLSTQVSLDTDFVKTGANNLPHFKKLIMVLCKELYSEVTRTLPTLEALQRLFDQQL
SPGIRSRPQACAEASPVNIMAKLGQLTSLLSSLEDKGKAFLGGGPESTHRRSLIPPVTFE
VKSESLGIPQKMQLKVDVESGKLIIKKSKDGPEDKFYSHKKILQLIKSQKFHNKLVIVVE
TEKEKTLRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGDAPPPKKI
TSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLGEKEWLEILKHSLQEITDITFKMVAI
HTLWNIRIVVLAKLEHENRISHICTNNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHL
TSGSEKKLRRNQNYMSILRFLALGDKKLSPFNITHRFTHLFWLGDLNYRLELPPSEAENI
IQKIKQQQYPELLLHDQLLTERKEQKVFLHFEEEEITFAPTYRFERLTREKYAYTKQKAT
GMKYNLPSWCDRVLWKSYPLVHVVCQSYGCTSDIMTSDHSPVFATFEVGVTSQFVSKNGP
GNVDSQGQIEFLNCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGTEGELVVKFAD
DLPKLTPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRSEAIESLVPIYTALTHHGE
MMGHFRGEIKLQTSQGKKRERLYDFVKIERDEASGQKSLKSLISHDPIKQWECSSRLTDL
GKNMAEPSPMDEQLLAKPEMFENPLYGAVSVFPKPAPRKEQESPQTLRKDRPGCPDPGTP
SPAVIFTKPPEGEGKLASRQTSAPLLPVPRMRSFTCSSSTEGRTTLSGEKTQGKPKPSTP
SENPVPAKRPVKPVRSEMSQQGNPAQTSRPPLPAKSPAVLHLQHSKARDYRESSELPHHG
KHWPEEGPTSRTSMQ
Download sequence
Identical sequences F7GAI6
ENSMODP00000028657 XP_007485891.1.35504 ENSMODP00000028657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]