SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GC88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GC88
Domain Number 1 Region: 209-294
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-18
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 2 Region: 279-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000375
Family EGF-type module 0.0025
Further Details:      
 
Weak hits

Sequence:  F7GC88
Domain Number - Region: 180-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000186
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 146-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00266
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7GC88
Sequence length 341
Comment (tr|F7GC88|F7GC88_MACMU) Fibrillin 2 {ECO:0000313|Ensembl:ENSMMUP00000014007} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=FBN2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGRRRRLCLQPYFLWLGCVALWAQGTAGQPQPPPPKPPRPQPPPQQVRSATTGSEGGFLA
PEYREEGAAVASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCG
DGFCSRPNMCTCSSGQISPTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGAYCGQPVC
ENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCC
ATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFE
CRCPAGHKQSETTQKCEVHVDKAQAGARCPCVIPPSRLYLR
Download sequence
Identical sequences A0A2K5VX30 A0A2K6BAZ9 F7GC88
ENSMMUP00000014007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]