SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GDL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GDL7
Domain Number 1 Region: 228-386
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.19e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000321
Further Details:      
 
Domain Number 2 Region: 15-124
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-33
Family Spermadhesin, CUB domain 0.00072
Further Details:      
 
Domain Number 3 Region: 127-225
Classification Level Classification E-value
Superfamily LCCL domain 3.92e-25
Family LCCL domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GDL7
Sequence length 712
Comment (tr|F7GDL7|F7GDL7_MONDO) Discoidin, CUB and LCCL domain containing 2 {ECO:0000313|Ensembl:ENSMODP00000002875} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=DCBLD2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
TGAQQGDGCGHTVLGPESGTFTSINYPHSYPNSTVCEWEIRVKTGERVHIKFGDFDIEDS
DSCHFNYLRVYNGIGLSRTEIGKYCGLGLQMNHSIESKSNEMTVLFMSGTHVSGRGFLAS
YSVINKPDLITCLDTATNFLEPEFSKYCPAGCLIPFAEISGTIPHGYRDSSSLCMAGIHA
GVVSNNLGGQISVVISKGIPYYESSLANNVTSVVGQLSASLFTFKTSGCYGTLGMESGVI
SDFQITSSSVWMDYTEQQNSWKPEKARLKKPGTSWAANDMNKYQWLQIDMNKEKKITGII
TTGSTMIEHNYYVSAYRILYSDDAQKWTVYREPGIEQDKVFQGNTDYYQDVRNNFIPPII
ARFVRINPVQWQQKIAMKVELLGCQFIPIGRAPKLTQPPFSRNNNEIRNTTFTSYVAKGR
APKFNRPPPRHGITLQTDQTTMTPDIKNTTVTPNLTKDVALAAVLVPVLVMVLTTLILIL
VCGWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFFPAKSLEHEETPVRYSSSEVSHLRPR
EVTSVLQTETAEYAQPLVGGIGTLHQRSTFKPEEGKEAGYADLDPYNAPVPEVYHAYAEP
LPITGPEYATPIVMDMSAHPAASGAAPSTSTFKAPGNKAPPLVGTYNSLSRTDSGPVARA
EYDTPKGGKPGLSAPDETMYQVPQGTLHTAGSKGEVSGAGREGEGDMFKEVL
Download sequence
Identical sequences F7GDL7
ENSMODP00000002875 ENSMODP00000002875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]