SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GEL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GEL9
Domain Number 1 Region: 153-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-49
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 406-507
Classification Level Classification E-value
Superfamily PH domain-like 3.52e-19
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7GEL9
Sequence length 792
Comment (tr|F7GEL9|F7GEL9_MONDO) Pleckstrin homology and RhoGEF domain containing G6 {ECO:0000313|Ensembl:ENSMODP00000022509} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PLEKHG6 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MKGYSTPDEGHLFHGLVASRIETYGGRHHRDPNNKAPWNLHLGKTTQQDTSHHRLQDLVA
FRYSGQSRGSSPLRLKDPESEKKHGGYFGSTPSSSPKLKEVAKARQLEMRLHTFSMFGMP
RLPPEDRRHWEIGEGGDNNLTIEKSWKELVPGHKEMSRGFCHQQEALWELLTTELLYIRK
LKIMTELLAAGLLNLQRVGLLTEVSAETLFGNVPNLIRAHQSFWEEVLEPTLKKTQISGQ
PLDPLGLQDGFLTFGQRFQPYIKYCVRVKQTMAYAREQQDNNPLFQIYVQWCEKHKRSGR
QQLSDLLIKPHQRITKYPLLLQAVLKRTPEPQVQDVLSAMISSVEAFLHHINSQVRQGEE
HDSLAAAAQRIGPYEVLEPSTEEVEKSLRPFSILDLTSPMLGVDHQHTRQLLLEGSVRMK
EGREGKDVYLFLFSDVILVTKPQRKADKAKVIRPPLMLEKLVCQALRDPNSFLMIHLTDF
QCVSSALVFHCSNPNECVHWLEKIQEAQVTLQKLKTEEYVHQKRELLALYRDIESPSTVP
PTPSPEGSQSSVEDHNLERSGTAEFPVLIPHLVVTEDREDSSLGMDDGSDSGYGTSSLPE
SQTPWIHRRRPALRQDPRLTLSTLDLRDIPRRLQPSNPHAPQRQSAPDLPEGDIIQEGHG
LPRRMPPNWSEKEEEEEGPSTGGNIVMETLHRAQLRGQLPFSPSQVDSAGESPWDSSGEE
EEESPLFVVPKRAEDMLQEIREDLASQRIDGISERVRESRNGQPRKLTIVELQRMRGPQI
IRLDTPLTTSEV
Download sequence
Identical sequences F7GEL9
XP_007503704.1.35504 ENSMODP00000022509 ENSMODP00000022509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]