SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GEV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GEV3
Domain Number 1 Region: 13-43
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000989
Family HLH, helix-loop-helix DNA-binding domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GEV3
Sequence length 74
Comment (tr|F7GEV3|F7GEV3_CALJA) Hes family bHLH transcription factor 2 {ECO:0000313|Ensembl:ENSCJAP00000000273} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HES2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGREDASCWQLPLHSQN
RLLLSIQAPEQPPA
Download sequence
Identical sequences F7GEV3
ENSCJAP00000000273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]