SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GGH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GGH3
Domain Number 1 Region: 75-176
Classification Level Classification E-value
Superfamily SH2 domain 1.21e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 168-214
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000017
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7GGH3
Sequence length 215
Comment (tr|F7GGH3|F7GGH3_MACMU) Suppressor of cytokine signaling 1 {ECO:0000313|Ensembl:ENSMMUP00000014368} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=SOCS1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPAPAPGDTHFR
TFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALS
VKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGTPLRQRRVRPLQE
LCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences A0A2K5UBA5 F7GGH3
XP_001104595.1.72884 XP_005591319.1.63531 ENSMMUP00000014368 ENSMMUP00000014368 9544.ENSMMUP00000014368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]