SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GJE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GJE2
Domain Number 1 Region: 84-131
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 3.27e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 314-357
Classification Level Classification E-value
Superfamily UBA-like 0.000000357
Family CUE domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7GJE2
Sequence length 492
Comment (tr|F7GJE2|F7GJE2_MONDO) DMRT like family A1 {ECO:0000313|Ensembl:ENSMODP00000004693} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=DMRTA1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEAASGSSSDTSRQALSSGLVAPATAVTSSSLPMASGMAIPPAFLRPPSLFLRAAAVAAA
GSVAGPSAARLERGVGALSCGGYPRTPKCARCRNHGVVSALKGHKRFCRWRDCACAKCTL
IAERQRVMAAQVALRRQQAQEENEARGLQRLLYPGQASGSRGAGGCAGSEISPAAGGGSG
TAEGLNLGTGALGSRRAVPFEIFHPDYQEEKRDSKVQKVGSYYNGLDGPITTSHQLSLRS
PESIGTNGDDEEKPSGSENSDKEENIQSPHPEEQSEGTESPRSLSSSDMESGNESEWAKD
FAAARSNLPTISSRPRDPLDILTKVFPSYKRSRLESILQYCKGDVVQAIEQVLNGKEHKQ
DTVDLANSVGTELTAFQRTNFTLAGLGIGTLGNKSAFSPLHTSSTPFGGDPNLYSLNPRL
GISPLRLSYSCPGRALSGFMSPYLTSGLVPALPFRPAIDYSFSGMIRDASYFPSKDSVTS
SGLYSRLNQENQ
Download sequence
Identical sequences F7GJE2
ENSMODP00000004693 ENSMODP00000004693 XP_001374014.1.35504 13616.ENSMODP00000004693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]