SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GLK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GLK9
Domain Number 1 Region: 66-324
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.51e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000642
Further Details:      
 
Domain Number 2 Region: 330-433
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.37e-23
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 3 Region: 14-84
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.0000000863
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7GLK9
Sequence length 443
Comment (tr|F7GLK9|F7GLK9_CALJA) Threonyl-tRNA synthetase 2, mitochondrial (putative) {ECO:0000313|Ensembl:ENSCJAP00000011912} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TARS2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEHNPLPTSPADQFNTGRYCRGPSTENGFYHDFFLGKERCGTLVDLCRGPHLRHTGQIGG
LKLLSAEYARRGFFEVKTPTLFSTKLWEQSGHWEHYQEDMFAVQPPGSDRPASSQSDHST
RHTTDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLCGLTRLRCFQ
QDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVL
QQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQA
GALERPVLIHRAVLGSVERLLGVLAESCRGKWPLWLSPFQVVVIPVGTEQEEYARETQQS
LQAAGLVCDLDADSRLTLSRRIRRAQLAHYNFQFVVGQKEQSKSTVNIRTRDNRLLGEWS
LPEAVQRLVVLQNTRVPNAEEIF
Download sequence
Identical sequences F7GLK9
ENSCJAP00000011912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]