SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GM26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GM26
Domain Number 1 Region: 647-783
Classification Level Classification E-value
Superfamily EF-hand 0.00000000175
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 477-530,567-691
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000018
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7GM26
Sequence length 973
Comment (tr|F7GM26|F7GM26_CALJA) Polycystin-2 {ECO:0000313|EMBL:JAB08811.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PKD2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MVNSRRVQPQQPGDAKQSPAPRAPGPGRLMAGGAAVGASLAARGGLREQRGLEIEMQRIR
QAAARDPPAGASASPSPPLSSCSRQAWSRDNPGFEAEEEEEEEEEEEVEGEEGGMVVEMD
VEWRPGSRRSAASSAVSSAGARSRGLGGYHGAGHPSGRRHRREDQGPPCPSPTGGGDPLH
RHLPLDGQPPRVAWAVRLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLC
ILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKM
QPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDR
APFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWL
DRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAA
CEIIFCFFILYYLVEEILEIRIHKLHYFRSFWNCLDVLIIVLSVVAIGINIYRTSNVDVL
LQFLEDQNTFPNFEHLAYWQIQFNNVAAVIVFFVWIKLFKFINFNRTMSQLSTTMSRCAK
DLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRV
LGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKL
KLKKNTADDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEH
QQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVS
YEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLG
RDGEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPCPRSSRPSSSQSTEGM
EGAGGNGNSNVHI
Download sequence
Identical sequences F7GM26
ENSCJAP00000011724 XP_002745652.1.60252 ENSCJAP00000011682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]