SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GPZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GPZ6
Domain Number 1 Region: 69-189
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.22e-26
Family Frizzled cysteine-rich domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7GPZ6
Sequence length 787
Comment (tr|F7GPZ6|F7GPZ6_CALJA) Smoothened, frizzled class receptor {ECO:0000313|Ensembl:ENSCJAP00000018990} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SMO OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MATARPARGPELPLLGLLLLLLLGGPGRGAASSGNATGPEPRSAGGSARRSAAVTGPPPP
LSHCGRAASCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWA
VIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTN
EVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAV
TGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGT
MRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYF
HLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEW
ERSFRDYVLQQIQLMVSCPSHPCPSLCTALSQTSLLLREVQHRFTMLARIVLIAWPPTAS
SPIFPIPSALRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPV
AGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAE
ISPELQKRLGQKKKRRKRKKEVCPLAPPPELHPPAPAPSTVPRLPQLPRQKCLVAAGAWG
AGDSCRQGAWTLVSNPFCPEPSPPQGPFLPSAPAPMAWAHGRRQGLGPIHSRTNLMEAEL
MDADSDF
Download sequence
Identical sequences F7GPZ6
ENSCJAP00000018997 ENSCJAP00000018990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]