SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GQN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GQN9
Domain Number 1 Region: 99-173
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.29e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GQN9
Sequence length 227
Comment (tr|F7GQN9|F7GQN9_CALJA) Basic helix-loop-helix family member e23 {ECO:0000313|Ensembl:ENSCJAP00000018454} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=BHLHE23 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAELKSLSGEAYLALSQGYSAAAAGLAYGAARGPNSARGYGALGPGGDLPAVPAPRAPAP
AAESSGEQSGDEDDAFEQRRRRRGPGGAGDARRRPREQRSLRLSINARERRRMHDLNDAL
DGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALDEMRRLVAFLNRGQGLAAPVST
AAPLTPFGQAAVCPFSAGGAALGPCPDKCAAFSGTPSALCKHCTEKP
Download sequence
Identical sequences F7GQN9
ENSCJAP00000018454 ENSCJAP00000018454 XP_017828595.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]