SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GQY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GQY9
Domain Number 1 Region: 125-351
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.28e-44
Family Voltage-gated potassium channels 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7GQY9
Sequence length 951
Comment (tr|F7GQY9|F7GQY9_CALJA) Potassium voltage-gated channel subfamily Q member 5 {ECO:0000313|Ensembl:ENSCJAP00000018246} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KCNQ5 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLL
LGTRAATLGGGGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLE
RPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQIL
RMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYAD
ALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQ
KHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKSLDSFQAAHKFCS
NKQKLFRMYTSRKQSQKLSFKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKV
QKSWSFNDRTRFRPSLRLKSSQPKPVIDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTV
IRAIRIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQIT
SDKKSREKITAEHETTDDLSMLGRVVKVEKQVQSIESKLDCLLDIYQQVLRKGSASALAL
ASFQIPPFECEQTSDYQSPVDSKDLSGSGQNSGCLSRSTSANISRGLQFILTPNEFSAQT
FYALSPTMHSQATQVPMSQSDGSAVAATNTIANQINPAPKPAAPTTLQIPPPLPAIKHLP
RPETLHPNPAGLQESISDITTCLVASKENVQVAQSNLTKDRSVRKSFDMGGETLLSVCPM
VPKDLGKSLSVQNLIRSTEELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEET
ETDTFDAAQQPAREAAFASDSLRTGRSRSSQSICKAGESTDALSLPHVKLK
Download sequence
Identical sequences F7GQY9
ENSCJAP00000018246 ENSCJAP00000018242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]