SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GRC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GRC7
Domain Number 1 Region: 65-130,160-199
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000728
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GRC7
Sequence length 236
Comment (tr|F7GRC7|F7GRC7_CALJA) Rhotekin {ECO:0000313|Ensembl:ENSCJAP00000032332} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=RTKN OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
WLMLSPISLSGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLYGSVCCRLAA
QPLCMTQPTASGTLRVQQAGEMQNWARVHGVLKGTNLFCYRRPEDANTGEEPLITIAINK
PFLPTLVSRKQMTGLSKSPQAHPSKETRVRAGELDQAQGRPFTLSISNQYGDDEVTHTLQ
TESREALQSWMEALWQLFFDMSQWKQCCDEIMKIETPTPRKPPQALAKQGSLYHEM
Download sequence
Identical sequences F7GRC7
ENSCJAP00000032332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]