SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GRS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GRS3
Domain Number 1 Region: 43-565
Classification Level Classification E-value
Superfamily SIS domain 8.62e-214
Family Phosphoglucose isomerase, PGI 0.00000000000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7GRS3
Sequence length 569
Comment (tr|F7GRS3|F7GRS3_CALJA) Glucose-6-phosphate isomerase {ECO:0000256|RuleBase:RU000612} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GPI OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MIALCSLQLLGCDDPRALLTLPTATMGERPAKRLLKSPTMAALTRDPQFQKLQQWYREHG
SELNLRRLFDTDEERFNHFSLTLNTNHGHILVDYSKNLVTEEVMRMLVDLAKSRGVETAR
ERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQGPLMVTE
ALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWF
LQVAKDPSAVAKHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVG
FDNFEQLLSGAHWMDQHFRTTPLEKNAPILLALLGIWYINCFGCETHAMLPYDQYLHRFA
AYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIP
VQTQHPIRKGLHHKILLANFLAQTEALMRGKSTDEARKELQAAGKSPEDLEKLLPHKVFE
GNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPEL
DGSAQVTSHDASTNGLINFIKQQREARVQ
Download sequence
Identical sequences F7GRS3
ENSCJAP00000020113 ENSCJAP00000019301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]