SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GSD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GSD1
Domain Number 1 Region: 524-836
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.11e-94
Family Hect, E3 ligase catalytic domain 0.0000000564
Further Details:      
 
Domain Number 2 Region: 20-158
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.14e-29
Family Synaptotagmin-like (S variant) 0.05
Further Details:      
 
Domain Number 3 Region: 469-509
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000249
Family WW domain 0.00012
Further Details:      
 
Domain Number 4 Region: 182-225
Classification Level Classification E-value
Superfamily WW domain 0.000000000000167
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 342-382
Classification Level Classification E-value
Superfamily WW domain 0.000000000000445
Family WW domain 0.0018
Further Details:      
 
Domain Number 6 Region: 421-455
Classification Level Classification E-value
Superfamily WW domain 0.00000000000278
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7GSD1
Sequence length 843
Comment (tr|F7GSD1|F7GSD1_MACMU) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=NEDD4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MATCAVEVFGLLEDEENSRIVRVKVIAGIGLAKKDILGASDPYVRVTLYDPVNGVLTSVQ
TKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRL
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDA
ACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQA
QRAFTTRRQISEETESVDNRESSENWEIIREDEATMYSSQAFPSPPPSSNLDVPTHLAEE
LNARLTIFGNSATSQSASSSNHSSRRGSLQAYTFEEQPALPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSSQQVTQPSEIEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSSDLGPLPPGWE
ERTHTDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIP
NKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEM
FNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPF
YKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGS
EIVERPLALPIREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNG
FAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFD
GVD
Download sequence
Identical sequences F7GSD1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]