SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GSM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GSM1
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily POZ domain 9.03e-18
Family BTB/POZ domain 0.000064
Further Details:      
 
Domain Number 2 Region: 86-157
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000000000000916
Family Skp1 dimerisation domain-like 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GSM1
Sequence length 161
Comment (tr|F7GSM1|F7GSM1_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000024539} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
IPSIRLQSSDGEIFGVDVEIAKESVTLKTMLEDLGMDDEGDDDPVPLPNVNATILKRKII
QGCTHHKDDPPPPDDGENKEKQTDTIPVWDQEFLKVDQGTLFKVIVAAHQLDIKGLLDAP
CKTVALITGEAPEEQSSIDTKTDFTNEEAQVPKENPWCKET
Download sequence
Identical sequences F7GSM1
ENSCJAP00000024539 ENSCJAP00000024539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]