SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GTP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GTP4
Domain Number 1 Region: 712-939
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-59
Family DBL homology domain (DH-domain) 0.000000000823
Further Details:      
 
Domain Number 2 Region: 310-486
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.07e-57
Family Regulator of G-protein signaling, RGS 0.0000000188
Further Details:      
 
Domain Number 3 Region: 943-1077
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-43
Family Pleckstrin-homology domain (PH domain) 0.000000248
Further Details:      
 
Domain Number 4 Region: 27-121
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-21
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  F7GTP4
Domain Number - Region: 149-159
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7GTP4
Sequence length 1520
Comment (tr|F7GTP4|F7GTP4_CALJA) Rho guanine nucleotide exchange factor 11 {ECO:0000313|Ensembl:ENSCJAP00000012062} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ARHGEF11 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSVRLPQSIDRLSSLSSLGDSAPERRSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGIPGLQQDPFPAGAPRVTPAIPPPPPPPPLPPPQRITGPRPLQDPEVQKHATQ
ILRNMLRQEEKELQDILSLCGDTGQRQSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNR
NSVLSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDP
GYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQTSPKESRSL
GKDIWSIFLEKNAPLRVKIPEMLQAEIDLRLRNSEDARGVLCEAQEAAMPEIQEQIHDYR
TKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYM
SHAGIRLREARPSNAAEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYI
GKPKSSSQSTFIFFLLLVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDS
SRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTR
SLENPTPPFTPKMGRRSIESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGK
DVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNL
PELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALEL
IKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSE
HEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLDLT
TRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTF
SPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRHAT
RHPGAAPMPVHPPPPGPQEPAHQGSTPSRVELDDSDVFHGEPEPEELPGGTGPQQRVQGK
HPVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGVRTRNPIHLAFPGPLFMEGLADSAL
EDVENLRRLILWSLLPGHTMETQAAREPEDDVTPTPSVIGVTSHPWDPGSPGQALPGGEG
DNTQIPGPEGERPEQENMALCSLEDLPPRTRNSGIWESPELDRNPAEEASSTEAAGGYKV
VRKAEVAGSKVVPALPESGQSEPEPPEVESGTKATGNCFYVSMPAGPLDSSTDLSGAPTS
PPQPDSFPAGQIEPQPQLQGGNGDPRCLSRSPPSLALRDVGMIFRTIEQLTLKLNRLKDM
ELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPCPE
DGSDTPLEESAADAATSPGP
Download sequence
Identical sequences F7GTP4
ENSCJAP00000012062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]