SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GUC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GUC3
Domain Number 1 Region: 67-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7GUC3
Sequence length 154
Comment (tr|F7GUC3|F7GUC3_MACMU) Inhibitor of DNA binding 1, HLH protein {ECO:0000313|Ensembl:ENSMMUP00000005880} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ID1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKVASGSTAAAAGPSCALKAGKTAGGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQ
VNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGR
GLPVRAPLSTLNGEISALTAEAACVPTDDRILCR
Download sequence
Identical sequences A0A0D9RK08 A0A2K5LS81 A0A2K5WAV6 A0A2K6D8E9 F7GUC3
ENSMMUP00000005880 ENSPANP00000016883 9544.ENSMMUP00000005880 ENSMMUP00000005880 NP_001253280.1.72884 XP_005568684.1.63531 XP_008018213.1.81039 XP_011764589.1.29376 XP_011907825.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]