SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7GW15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GW15
Domain Number 1 Region: 605-682
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000474
Family HLH, helix-loop-helix DNA-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GW15
Sequence length 798
Comment (tr|F7GW15|F7GW15_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000032728} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
PEDNDDSDTDEPSPGLGRDEPPRRQQIIHSGHFMVSSPHREHPPKKGYDFDTVNKQTCQT
YSFGKTSSCHLSVDTSPTKLFKCMTLAYSGKLVSPKWKNFKDLKLQWRDKIWLNNAIWRA
WYMQCLEKGKNPVTPLDGSVDVEKHCRPEAITTEEKYWKSRMEIVIREYHKWRTYFKKRL
QQHKDEDLSSLAQDYDMLYWHKHRDGWKTPIPIEEHPLLDTDMLMSEFIHTLFSRLSSHQ
PVEIANLGNADMIQPGLMPLQPNLDFMDTFEPFQDLFSSSRSIFGSMLPAPASTPVPDSN
NPPAQESILHTTTLPTMSLPDSIIEPHAAPSLDPVDGQVCEHASQTEDPFIQPTDFSTSE
PPLSVPQPFLPVFTMPLLSPSPAPPPVSPLLLIVPPQPLPNRRLSSPTQPSPPSPMMPPP
PPSASPSPCPTVNPCGLTLSPVTRPPQPQLTSVHPKPVSLMGGRPKQPHKIVPAPKPEPV
SLVLKNTCITPAPFSGQPQAVIMTSGPLKREGMLASTVSQSNVVIAPAAIARAPGVPEFH
SSILVSSQAQHKTLGKAEQVPLHGGSPQVTVTGPSLDCPNSGQASQCTSEQSPSPQFPQN
NCSEKNRQMKHISAEQKRCVNIKMGDALNILISNNSRLTSHAITLQKTMEYITKLQQERG
QMQEEARRLREEIELNAAIISCQQLFPATGVPVTQFNHMRDMFDEYVKSQTQNWNFWIFS
IIIKPLFESFKGMVSISSLEELHCTALSWLDQHCSLPILRPMVLNTLRQLSTSSPILTDP
AQLPEQASEALTRIGKRL
Download sequence
Identical sequences F7GW15
ENSCJAP00000032728 ENSCJAP00000032728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]