SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GWR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GWR2
Domain Number 1 Region: 345-579
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 3-135,185-255
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.22e-28
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GWR2
Sequence length 633
Comment (tr|F7GWR2|F7GWR2_CALJA) Voltage-dependent L-type calcium channel subunit alpha {ECO:0000256|RuleBase:RU003808} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CACNA1S OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
EKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFTIVFLGVFTVILEQVNVIQ
SNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFM
VIIYAIIGLELFKGKMHKTCYFTGTDIVATVENEEPSPCARTGSGRRCTINGSECQGGWP
GPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFIL
NLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLDEDLRGYMSWITQGEVMDVEDFREGKL
SLDEGGSDTESLYEIAGLNKVIQFIRHWRQWNRIFRWKCHDIVKSKVFYWLVILIVALNT
LSIASEHHNQPLWLTHLQDIANRVLLSLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCS
GILEVLLVEVGAMTPLGISVLRCIRLLRIFKITKYWTSLSNLVASLLNSIRSIASLLLLL
FLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQSFSSEDWTSMMYNGIMA
YGGPAYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKM
SKGLPDKSEEEKSTMAKKLEQKPKGEGIPTTAK
Download sequence
Identical sequences F7GWR2
ENSCJAP00000009776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]