SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7H2T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H2T0
Domain Number 1 Region: 81-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.55e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.000000723
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7H2T0
Sequence length 222
Comment (tr|F7H2T0|F7H2T0_MACMU) Glutathione S-transferase alpha 3 {ECO:0000313|Ensembl:ENSMMUP00000053754} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=GSTA3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIESAEDLEKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKNRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISSFPL
LKALKTRISNMPTVKKFLQPGSPRKPPPDAKALEEARKIFRF
Download sequence
Identical sequences A0A023JCA5 A0A2K6CZ85 F7H2T0
ENSMMUP00000033535 ENSMMUP00000022540 NP_001248197.1.72884 NP_001276889.1.63531 XP_011755124.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]