SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7H2W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H2W1
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.95e-49
Family Phosducin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7H2W1
Sequence length 241
Comment (tr|F7H2W1|F7H2W1_MACMU) Phosducin like 2 {ECO:0000313|Ensembl:ENSMMUP00000008251} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=PDCL2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MQDPNEDTEWNDILRDFGILPPKEESKDEIEEMVLGLQKEAMVKPFEKMTLAQLKEAEDE
FDEEDMQAIETYREKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDVWVIIHLYRS
SIPMCLLVNQHLSLLARKFPETKFVKAIVNSCIQHYHDNCLPTIFVYKNGQIEAKFIGIL
ECGGINLKLEELEWKLAEVGAIQTDLEENPQKDIVDMMVSSIRNTSIHDDSDSSNSDNDT
K
Download sequence
Identical sequences A0A2K5U7V0 F7H2W1
XP_001087954.1.72884 XP_005555314.1.63531 ENSMMUP00000008251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]