SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7H2W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H2W9
Domain Number 1 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 650-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 538-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 23-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 9 Region: 594-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.81e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 692-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 11 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7H2W9
Sequence length 751
Comment (tr|F7H2W9|F7H2W9_MACMU) Zinc finger protein 184 {ECO:0000313|Ensembl:ENSMMUP00000010565} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ZNF184 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MEDLSSPDSTLHQGGHNLLSSASFQESVTFKDVIVDFTQEEWKQLDPGQRDLFRDVTLEN
YTHLVSIGLQDSKPDVISQLEQGTEPWIMEPSIPVGTCADWETRLENSVSAPEPDISEEE
LSPEVIVEKHKRDDSWSSNLLESWECEGSLERQQANQQTLPKEIKVTEKTIPSWEKGPVN
NEFGKSVTVSSNLVTQEPSPEETSVKRSIKQNSNPVKKEKSCKCNECGKAFSYCSALIRH
QRTHTGEKPYKCNECEKAFSRSENLINHQRIHTGDKPYKCDQCGKGFIEGPSLTQHQRIH
TGEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCNECGKAFSQRGHFMEHQKIHTGEK
PFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYEC
NECGKAFSQHSNLTQHQKTHTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCNECG
KAFSYCSSLTQHRRIHTREKPFECSECGKAFSYLSNLNQHQKTHTQEKAYECKECGKAFI
RSSSLAKHERIHTGEKPYQCHECGKTFSYGSSLIQHRKIHTGERPYKCNECGRAFNQNIH
LTQHKRIHTGAKPYECTECGKAFRHCSSLAQHQKTHTEEKPYQCNKCEKTFSQSSHLTQH
QRIHTGEKPYKCNECDKAFSRSTHLTEHQNTHTGEKPYNCNECRKTFSQSTYLIQHQRIH
SGEKPFGCNDCGKSFRYRSALNKHQRLHPGI
Download sequence
Identical sequences F7H2W9
9544.ENSMMUP00000034294 XP_014991240.1.72884 XP_014991241.1.72884 XP_014991242.1.72884 ENSMMUP00000010565 ENSMMUP00000010565 ENSMMUP00000034294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]