SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7H3N7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H3N7
Domain Number 1 Region: 573-603,642-720
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.32e-16
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7H3N7
Sequence length 740
Comment (tr|F7H3N7|F7H3N7_CALJA) Solute carrier family 26 member 2 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SLC26A2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSSEGKEQHDLSPRDSAEGNDLSSPSGIHLELQRESSTDFKQFETNDQCRPYPRILIERQ
EKSNTNFKQFVIKKLQKNCQCNPTKAKNMILGFLPVLQWLPKYDLKKNILGDVMSGLIVG
ILLVPQSIAYSLLAGQEPVYGLYTSFFASIIYFLLGTSRHISVGIFGILCLMIGETVDRE
LQKAGYDNAHSAPSLGMVSNGSTLLNQTSDRICDKSCYAIMVGTTVTFMAGVYQVAMGFF
QVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLNLPRSNGVGSLITTWIHIFRNIRE
TNPCDLITSLLCLLVLLPTKELNEHFKSKLKAPIPVELVVVVAATLASHFGKLHETYNSS
VAGHIPTGFMPPRVPEWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVRANQEMY
AIGFCNIIPSFFHCFTTSAALAKTLVKESTGCQTQLSGVVTALVLLLVLLVIAPLFYSLQ
KSVLGVITIVNLRGALRKFRDLPKMWSISRMDTVIWFVTMLSSALLSTEIGLLVGVCFSM
FCVILRTQKPKISLLGLVEGSEVFESLSAYKNLQTKPGIKIFRFVAPLYYINKECFKSAL
YKQTVNPVLIKAAWKKAAKRKVKEEVVTLGGIQDEVSVQLSHDSLELNTIVIDCSAIQFL
DTAGIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLTKGEYCQKEEENLLFYSVYEAMAFA
EASKNQKGICVPNGLSLSSD
Download sequence
Identical sequences F7H3N7
ENSCJAP00000039259 XP_002744409.1.60252 XP_008985994.1.60252 ENSCJAP00000039259 ENSCJAP00000048159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]