SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7H662 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H662
Domain Number 1 Region: 123-421
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-57
Family G proteins 0.00000861
Further Details:      
 
Domain Number 2 Region: 589-719
Classification Level Classification E-value
Superfamily Translation proteins 5.61e-34
Family Elongation factors 0.0013
Further Details:      
 
Domain Number 3 Region: 465-585
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 6.67e-33
Family Initiation factor IF2/eIF5b, domain 3 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7H662
Sequence length 721
Comment (tr|F7H662|F7H662_CALJA) Eukaryotic translation initiation factor 5B {ECO:0000313|Ensembl:ENSCJAP00000018415} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=EIF5B OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MDQGVPEKEETPPPVEPEEEEDTEDTGLDDWEAMASDEETEKVLVEGNTVHIEVKENREG
SEGDEEDEKVSDEKDSGKTLDKKPSKEMSSDSEYDSDDDRTKEERAYDKAKRRIEKRRLE
HSKNVNTEKLRAPIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAIN
EQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIE
SINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQKKNTKDEFEERAKAIIVEFA
QQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTMLSKRLAHCEELRAQ
VMEVKALPGMGTTVDVILINGRLKEGDTIIVPGVEGPIVTQIRGLLLPPPMKELRVKNQY
EKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLKDELIHELKQTLNAIKLEEK
GVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKASVMLEHDPQYAVILAFDV
RIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEYKHIAVFPCKMKILPQ
YIFNSRDPIVMGVTVEAGQVKQGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCV
KIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFEI
I
Download sequence
Identical sequences F7H662
ENSCJAP00000018415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]