SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7H6E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H6E7
Domain Number 1 Region: 237-491
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.42e-84
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 146-247
Classification Level Classification E-value
Superfamily SRCR-like 8.37e-20
Family Scavenger receptor cysteine-rich (SRCR) domain 0.068
Further Details:      
 
Domain Number 3 Region: 109-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  F7H6E7
Domain Number - Region: 8-69
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00575
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7H6E7
Sequence length 494
Comment (tr|F7H6E7|F7H6E7_CALJA) Transmembrane protease, serine 2 {ECO:0000313|Ensembl:ENSCJAP00000020714} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TMPRSS2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
FILNKGSPPGVGPYYENHGYQPENPYSAQPTVAPNGYMVYPAQYYPSPLPQYAPRVPTHA
SNPVVSTQPKSPSGRLCTSKTKKALCITLALGTVLTGAALAAGLVWKFMESKCSVSGIEC
GSSGTCVSPSNWCDGVSHCPSGEDENRCVRLYGPNFILQVYSSQRRSWHPVCQDDWNENY
GRVACRDMGYKNSFYSSQGIVDDSGATSFMKLNLSAGNVDIYKKLYHSGTCSSKAVVSLR
CVACGVTLNSSRQSRIVGGVTASEGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPRHWTAFVGILSQSLMFYGSGHRVEKVISHPSYDSQTKNNDIALMKLQTPLTFSET
DAVKPVCLPNPGMNLDPEQPCWISGWGATEEKGKTSDMLNAAMVPLIDPQRCNSRYVYNN
LITPAMICAGFLKGTVDSCQGDSGGPLVTLKNSVWWLIGDTSWGSGCAKAYRPGVYGNVT
VFTDWIYQQMRVTI
Download sequence
Identical sequences F7H6E7
ENSCJAP00000020714 ENSCJAP00000020729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]