SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7H6U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H6U9
Domain Number 1 Region: 93-152
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.83e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7H6U9
Sequence length 213
Comment (tr|F7H6U9|F7H6U9_CALJA) Heart and neural crest derivatives expressed 1 {ECO:0000313|Ensembl:ENSCJAP00000018003} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HAND1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGG
PPPAAAAAAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIP
NVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKVDSGRESKRKRELQ
QHEGFPPALGPGEKRIKGRTGWPQQVWALELNQ
Download sequence
Identical sequences F7H6U9
ENSCJAP00000018003 ENSCJAP00000018003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]