SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7H7X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H7X1
Domain Number 1 Region: 50-111
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 2 Region: 122-189
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000273
Family Eukaryotic type KH-domain (KH-domain type I) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7H7X1
Sequence length 375
Comment (tr|F7H7X1|F7H7X1_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000035636} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
METEQPEETFPNTETNSEFGKRPAEDMEEEQAFKRSRNTEEKFELSMLLQSKYGGVTGKG
GKNIKALRTDYTASVSVPDNSGPKRILNISADFETVGEILKKIISTLEERLQLEVTLTDC
ALRLLTHQNLAVGITGVKDAKIKELQENTQTTIKPFQECCPHSTNKVVLIGGKPDRVVAC
IKINLDLISESPIKGYSQPYDPNFYDKTYDFGGFTMFDDRHGLRVGFPTRGTDGFDRMPL
GRWHPMPPSRRDYDDIRDYDGPPFPPTGCGWGGSRAWNLPLPPPSPPRRGDLMAYDRRGR
PGDCYNGMVGVSADETWDSAIDTWSPSEWQMAYEPQGGSRYDYSYAGGCGSYGDLGGPVT
TTQVTISKDLAGCRL
Download sequence
Identical sequences F7H7X1
ENSCJAP00000035636 ENSCJAP00000035636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]