SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7H8G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H8G6
Domain Number 1 Region: 275-554
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-71
Family Kelch motif 0.0000249
Further Details:      
 
Domain Number 2 Region: 12-132
Classification Level Classification E-value
Superfamily POZ domain 4.71e-34
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7H8G6
Sequence length 558
Comment (tr|F7H8G6|F7H8G6_CALJA) Kelch-like protein 23 {ECO:0000313|EMBL:JAB04188.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PHOSPHO2-KLHL23 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MALKGQEDYIYLFKDSTHPVDFLDAFRTFYLDGLFTDITLQCPSGIIFHCHRAVLAACSN
YFKAMFTADMKEKFKNKIKLSGIHHDVLEGLVNYAYTSQIEITKRNVQSLLEAADLLQFL
SVKKACERFLVRHLDIDNCIGMHSFAEFHVCPELEKESRRILCSKFKEVWQQEEFLEISL
EKFLFILSRKNLSVWKEEAIIEPVIKWTAHDVENRIECLYNLLSYINIDIDPMYLKTALG
LQRSCLLTENKIRSLIYNALNSMHKEISQRSTATMYIIGGYYWHPLSEVHIWDPLTNVWI
QGAEIPDYTRESYGVTCLGPNIYVTGGYRTDNIEALDTVWIYNSESDEWTEGLPMLNARY
YHCAVTLGGCVYALGGYRKGAPAEEAEFYDPLKEKWIPIANMIKGVGNATACVLHDVIYV
IGGHCGYRGSCTYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITEC
YDPEQNEWREIAPMMERRMECGAVIMNGCIYVTGGYSYSKGTYLQSIEKYDPDLNKWEIV
GNLPSAMRSHGCVCVYNI
Download sequence
Identical sequences F7H8G6
ENSCJAP00000012369 ENSCJAP00000012386 ENSCJAP00000012369 XP_008996983.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]