SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7H950 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H950
Domain Number 1 Region: 101-159
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7H950
Sequence length 356
Comment (tr|F7H950|F7H950_MACMU) Neurogenic differentiation factor {ECO:0000256|PIRNR:PIRNR015618} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_04592 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGGEEE
DEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAA
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPT
TNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVF
HVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
MHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
Download sequence
Identical sequences A0A096MR04 A0A2J8PRL2 A0A2K5KIC7 A0A2K5PLZ4 A0A2K5XHM2 A0A2K6K0F5 A0A2K6ND93 A0A2K6S6W5 F6SAI0 F7H950 G3RPH8 G7PKY7 K7ET56
9544.ENSMMUP00000010871 9598.ENSPTRP00000021721 ENSMMUP00000010871 ENSCJAP00000021184 ENSPANP00000002190 HR3139 ENSMMUP00000010871 ENSPTRP00000021721 ENSCJAP00000021181 ENSPPYP00000023725 ENSGGOP00000017698 ENSPTRP00000021721 ENSPPYP00000023725 ENSGGOP00000025396 gi|121114306|ref|NP_002491.2| NP_001271545.1.63531 NP_002491.2.87134 NP_002491.2.92137 XP_001101116.1.72884 XP_001158946.1.37143 XP_002749298.1.60252 XP_002812695.1.23681 XP_003823593.1.60992 XP_003921857.1.74449 XP_004032954.1.27298 XP_010366987.1.97406 XP_011855433.1.47321 XP_011902568.1.92194 XP_017388244.1.71028 XP_017722977.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]