SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HC40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HC40
Domain Number 1 Region: 139-382
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.36e-70
Family Fibrinogen C-terminal domain-like 0.00000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7HC40
Sequence length 388
Comment (tr|F7HC40|F7HC40_MACMU) Angiopoietin like 5 {ECO:0000313|Ensembl:ENSMMUP00000027354} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ANGPTL5 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MMSPFQVSLLFVNVCIFICGEAVQGNCVHHSTDSSVVNIVEDVSNAKDESKSNDTVCKED
CEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQTSLDYLSNQVNELM
NRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFE
VMCDMDYRGGGWTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTS
FMLYVSLESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNAGDAFRGLKKEDNQNAMPF
STSDVDNDGCRPACLLNGQSVKSCSHLHNKTGWWFNQCGLANLNGIHHFPGKLLATGIQW
GTWTKNNSPVKIKSVSMKIRRMYNPYFK
Download sequence
Identical sequences F7HC40
XP_014971022.1.72884 ENSMMUP00000027354 9544.ENSMMUP00000027354 ENSMMUP00000027354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]