SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HCT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HCT7
Domain Number 1 Region: 37-168
Classification Level Classification E-value
Superfamily Lysozyme-like 1.39e-18
Family G-type lysozyme 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HCT7
Sequence length 178
Comment (tr|F7HCT7|F7HCT7_MACMU) Lysozyme g-like protein {ECO:0000256|PIRNR:PIRNR001065} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=LYG2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLSSVVFWGLIALIGTSRGSYPFTHSMNPHLHPRLYHGCYGDIMTMKTSGATCDAKSVMN
CGIRGSEMFAEMDLRAIKPYQTLIKEVGQRYCVDPAVIAAIISRESHGGSVLQDGWDHRG
LKFGLMQLDKQAYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWNAAQHLRGFFLL
Download sequence
Identical sequences F7HCT7
ENSMMUP00000036253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]