SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HCU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HCU7
Domain Number 1 Region: 81-150
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-17
Family HLH, helix-loop-helix DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HCU7
Sequence length 224
Comment (tr|F7HCU7|F7HCU7_CALJA) Myogenin {ECO:0000313|EMBL:JAB36198.1, ECO:0000313|Ensembl:ENSCJAP00000011870} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MYOG OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELSLSPEARGPLEDKGLGTPEH
CPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE
ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSTLEFG
ANPGDPLLAADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
Download sequence
Identical sequences F7HCU7
ENSCJAP00000011870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]