SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HD96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HD96
Domain Number 1 Region: 989-1106
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.81e-22
Family Protein kinases, catalytic subunit 0.00089
Further Details:      
 
Domain Number 2 Region: 132-231
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000545
Family N-terminal PAS domain of Pas kinase 0.0000053
Further Details:      
 
Weak hits

Sequence:  F7HD96
Domain Number - Region: 346-388
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00272
Family Heme-binding PAS domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HD96
Sequence length 1133
Comment (tr|F7HD96|F7HD96_CALJA) PAS domain containing serine/threonine kinase {ECO:0000313|Ensembl:ENSCJAP00000011662} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PASK OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEDGGVTAFEEDRRCLSQSLPLPVPAEGPSSQSTAECSRSPSSAHRHLSRRSGLSRLCQS
RTTLSEDRWSSYCLSSLAAQNICTSQLHCPAAPEHTDPAGPWGSVSCCSLLRGLSSGWSS
PLLPAPVCNPNKAIFTVDAKTTEILVANDKACRLLGYSSQDLIGQKLTQFFLRSDSDVVE
ALSEEHMEADGHAAVVFGTVVDIVSRSGEKIPVSVWMKKMRQEHRLCCVVVLEPVERVST
WVAFQSDGTVTSCDSLFAHLHGFVSGEDVAGRCITDLIPSLQLPPGQHIPKNLKIQRSVG
RARDGTTFPLSLKLKSEPSSEEVTTSEVAPLRDYWASVWVFCTISGLITLLPDGTIHGIN
HSFALMLFGYGKSELLGKNITFLIPGFYSYMDLANDSSLQLPDLASCLDVSDKSGCGETT
SDPWQGQDPAEGSQDPRINVLAGGHVLPRDEARKLVGSGDVFTGTQTELGTGGRLPSCLS
PQPAPGVDSVAEGSPPAHGEQVLPEDQHTTASGREEPAAVETPGQGLLGGSRPEPVDAKP
SASCEDSEAPGPAEDRGSNTGLCGLYQQAQLELTGVSGSDLWAGVAVAQPQAKGQLPVGS
LPMHCPCYRSEQGLWRRSQDLARSPSGVAGISLGTPTLDEPWLGVKNDQEELQTCLTKEE
LSELSLVGALDIPHAELVPAECPAFTAPVLSCDLGGRDLYSGCTGSSSACYALATDLPRG
LEEVQAQEVDVNSFSWNLKELVSRDQTEQTSSNCSCAMSELGGTPSSSAVCSDPDVGGLQ
EQGPCILDDRELLLLTGTCVDLGQGRGFLESCLGHDPTEPSEVCSVSSEHYAASDRGSPG
HFPSTLDAGPENTCPSAEETTLDVQVTSTPVMPGAAGLQREIQEGAYSGSCHHRDGLRLS
IRFEVRRVELQGPSPLFCCWLVKDLLHSHRDSAARTCLLLASLPGSTHSTTAELTGPSLG
EVLRAKPWFEDAPKAVELEGLAACEGEYSQKYSTLSRLGSGAFGSVWTAVDKEQNKEVVV
KFIKKEKVLEDCWIEDPDLGKVPLEIAILSRVEHANIIKVLDVFQNHGFFQLVMEKHGSG
LDLFAFIDCHPRLDEPLASYIFRQVRAGQSHGGVNASLGAWLQRSVIHTRFSL
Download sequence
Identical sequences F7HD96
ENSCJAP00000011662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]