SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HE31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HE31
Domain Number 1 Region: 31-79
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.93e-17
Family Ovomucoid domain III-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HE31
Sequence length 79
Comment (tr|F7HE31|F7HE31_MACMU) Serine peptidase inhibitor, Kazal type 1 {ECO:0000313|Ensembl:ENSMMUP00000022655} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_16991 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELTGCTKIYDPVCGTDGKTYPNECVL
CFENQKRQTSVLIRKSGPC
Download sequence
Identical sequences A0A096NAT0 A0A2K5NJ41 A0A2K5ZTE8 A0A2K6D3G8 F7HE31 G7P8L5
9544.ENSMMUP00000022655 ENSMMUP00000022655 ENSPANP00000009824 XP_001102888.1.72884 XP_005558227.1.63531 XP_011714399.1.29376 XP_011834399.1.47321 XP_011924077.1.92194 ENSMMUP00000022655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]