SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HEC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HEC9
Domain Number 1 Region: 6-280
Classification Level Classification E-value
Superfamily L domain-like 1.45e-50
Family Leucine rich effector protein YopM 0.044
Further Details:      
 
Domain Number 2 Region: 239-392
Classification Level Classification E-value
Superfamily L domain-like 7.65e-28
Family Internalin LRR domain 0.03
Further Details:      
 
Domain Number 3 Region: 842-952
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-25
Family PDZ domain 0.0000404
Further Details:      
 
Domain Number 4 Region: 714-812
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-24
Family PDZ domain 0.0000342
Further Details:      
 
Domain Number 5 Region: 997-1089
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-24
Family PDZ domain 0.0049
Further Details:      
 
Domain Number 6 Region: 1090-1187
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-23
Family PDZ domain 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HEC9
Sequence length 1620
Comment (tr|F7HEC9|F7HEC9_CALJA) Scribbled planar cell polarity protein {ECO:0000313|Ensembl:ENSCJAP00000039952} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SCRIB OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELG
GLVLLTDLLLSQNLLQRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LMALPRSLGKLTKLTNLNVDRNQLEALPSEIGGCVALSVLSLRDNRLAVLPPELAHTSEL
HVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDTRTGEKVLTCYLLPQQP
PPSLEDAGQQGSPSESWSDAPPSRISVIQFMEAPAGDEDAEEAAAEKRGLQRRATPHPSE
LKVMKRSIEGRWSEPCPCQPDPGLPLPVEEELQWSNPSWEEGAGDEAGDRIQEHGAAGPA
GDGAPGQMCRETCAAGVRGKAEAGVPGSTMGSVSLMPSGRRCLWRGGQGSLVWTWALGLG
HLLPRTACLVRGKRRGWAGSQQPPVALSLASLQRWHSPHPLTGGRLGPQSPRGGQALAPH
TLQRIALLLGWPLRWPWAVSGMRPHAAAQGKARNGVCTPAGSAESTGIPAGLSCTPRLFC
FQLTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVN
GVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRERRGGGL
RLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFISRIAEGGAAH
RAGTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPSSSPPHSSS
PSPTTTPSITTVTPGDAGLLRLAPGLLAATLEGPYPVEEIRLPRAGGPLGLSIVGGSDHS
SHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVREATHQEAVSALLRPCLEL
SLLVRRDPAPPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVSPMGAA
ERDGRLRVGLRLLEVNQQSLLGLTHSEAVQLLRGVGDTLTVLVCDGFDASTSAALEVSPG
VIANPFAAGISHRNSLDSISSIDRELSPEGPGKEKELPGQTLHWSEATEAAGRGLEPLKL
DYRALAAVPSAGSVQRVPSGAAGGKTAEAPHSPSGQQPPSPPSPDELPANVKQAYRAFAA
QLFRERQKYELKCACPAEGPPKRVSVSADDLRKMQEEEARKLQQKRAQMWEVAEAGAGAR
LALDAETLGEEEQEDEEPLWAGPSPTAGQSPVSPPPPGGAAPVRTAKAERRHQERLRVQS
PELPAPERALSPAERRALEAEKRALWRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLER
LAEAPSPAPTPSPTPVEDLGPQTSTSPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFA
EELRSLEPSPSPGPQEEDGEVALVLLGRPSPGTVGPEDVALCSSRRPIRPGRRGLGPVPS
Download sequence
Identical sequences F7HEC9
ENSCJAP00000039952 ENSCJAP00000039952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]