SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HER3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HER3
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000419
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 731-857
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000455
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000466
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000133
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000392
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000323
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 708-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  F7HER3
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000392
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 853-912
Classification Level Classification E-value
Superfamily FnI-like domain 0.000847
Family VWC domain 0.043
Further Details:      
 
Domain Number - Region: 414-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0311
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 263-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0692
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HER3
Sequence length 1218
Comment (tr|F7HER3|F7HER3_CALJA) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=JAG1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
YRVPAARGATMRSLSLLLALLCTLRAKVCGAAGQFEWELLSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGQGSTPVIGGNTFTFKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNNTLPWPSLLRPPSRFSENVTPSSPWLPEQHSIGRPNF
EYQNPCDCDDYYYGFGCNKCRPRDDFFGHYTCDQNGNKTCMEGWMGSECNRAICRQGCST
KHGSCKHPGDCRCQYGWQGLYCDKCIPHPGCVHGICIEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGACSNTGPDKYQCSCPEGYSGVSCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCQDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQSGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GTYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAMCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR
PCLLHKGHSECPNGQNCIPILDDQCFVRPCTGVGECRSSGLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPVKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRQPQKNRTDFLVPLLSSVLTVA
WICCLATALYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNSTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
Download sequence
Identical sequences F7HER3
ENSCJAP00000039752 ENSCJAP00000039752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]