SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7HET4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HET4
Domain Number 1 Region: 359-561
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-29
Family Kelch motif 0.0016
Further Details:      
 
Domain Number 2 Region: 72-198
Classification Level Classification E-value
Superfamily POZ domain 3.35e-27
Family BTB/POZ domain 0.0027
Further Details:      
 
Domain Number 3 Region: 593-659
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000942
Family Kelch motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HET4
Sequence length 708
Comment (tr|F7HET4|F7HET4_CALJA) Kelch like family member 11 {ECO:0000313|Ensembl:ENSCJAP00000027770} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KLHL11 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
HIVPRLRRPGAAASTASLQVLEMESMETAAAGSAGLAAEVRGSGTVDFGPGPGISAMEAS
GGDPGPEAEDFECSSHCSELSWRQNEQRRQGLFCDITLCFGGAGGREFRAHRSVLAAATE
YFTPLLSGQFSESRSGRVEMRKWSSEPGPEPDTVEAVIEYMYTGRIRVSTGSVHEVLELA
DRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLALKAADMIRRNFHKVIQDEE
FYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFKLLRLSQMKPT
YLTRHVKPERLVANNEVCVKLVADAVERHALRAENIQSGTFQLPTSHVSLLPRYGQNMDV
IMVIGGVSEGGDYLSECVGYFVDEDRWVNLPHIHNHLDGHAVAVTESYVYVAGSMEPGFA
KTVERYNPNLNTWEHVCSLMTRKHSFGLTEVKGKLYSIGGHGNFSPGFKDVTVYNPELDK
WHNLESAPKILRDVKALGIEDRFVYIAARTPVDRDTEDGLKAVITCYDTETRQWQDVESL
PLIDNYCFFQMSVVNSNFYQTASCCPKSYCLENEEAVRKIASQVSDEILESLPPEVLSIE
GAAICYYKDDVFIIGGWKNSDDIDKQYRKEAYRYCAERKRWMLLPPMPQPRCRATACHVR
IPYRYLHGTQRYPMPQNLMWQKDRIRQMQEIHRHALNMRRVPSSQIEC
Download sequence
Identical sequences F7HET4
ENSCJAP00000027770 ENSCJAP00000027767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]