SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HEV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HEV3
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 3.73e-32
Family Pleckstrin-homology domain (PH domain) 0.000000285
Further Details:      
 
Domain Number 2 Region: 169-262
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000171
Family SH2 domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7HEV3
Sequence length 295
Comment (tr|F7HEV3|F7HEV3_MACMU) Signal-transducing adaptor protein 1 {ECO:0000313|EMBL:AFH29761.1} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_15850 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLVKRSGYQEYEHYWTELRGTTLFFYTDK
KSTIYIDKLDIIDLTCLAEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVT
ELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFY
TVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDMPRIKHYKVMSVGQNYTIEL
EKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPNMEGRSEKLKKNPHIA
Download sequence
Identical sequences A0A2K5X8B9 A0A2K6BBL9 F7HEV3
9544.ENSMMUP00000012295 NP_001181374.1.72884 XP_005555248.1.63531 XP_011709106.1.29376 ENSMMUP00000012295 ENSMMUP00000012295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]