SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HFW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HFW4
Domain Number 1 Region: 441-743
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-72
Family Protein kinases, catalytic subunit 0.000000398
Further Details:      
 
Domain Number 2 Region: 278-400
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 66-154
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-21
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  F7HFW4
Domain Number - Region: 172-259
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0418
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7HFW4
Sequence length 941
Comment (tr|F7HFW4|F7HFW4_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000003182} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ROR2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
PGRGAPARALLCFPAVCAAAGLLLSVSRTSGEVEVLDRNDPLGPLDEQDGPIPTLKGYFL
NFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRI
QDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNNNFQDDYHEDGFCQPYRGIAC
ARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCDAR
SRAPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMR
IGIPAERLGRYHQCYNGSGTDYRGTASTTKSGHQCQPWALQHPHSHRLSSTDFPELGGGH
AYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIACLF
FLVCMCRNKQKASASMPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELGED
RFGKVYKGHLLGPAPGEQTQAVAIKTLKDKADGPLREEFRHEAMLRARLQHPNIVCLLGV
VTKEQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSADDDRTVKSALESPDFVLLVAQIAAG
MEYLSSHHVVHKDLATRNVLVYDKLTVKISDLGLFREVYAADYYKLLGNSLLPIRWMAPE
AITYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVY
ALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSNVS
NARYVGPKQKAPPFPQPQFMPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQI
PMQMAPQQVPPQMLPKPSSHHSGSGSSSTGYVTTAPSNTSMADRAALLSEGTKDSQNAPE
DGTQIPVQEAEEEKECSVPETELLGDSDTLQVDEAQVQLEA
Download sequence
Identical sequences F7HFW4
ENSCJAP00000003182 ENSCJAP00000003182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]