SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7HH65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HH65
Domain Number 1 Region: 3-107,227-341
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.45e-53
Family Phosphate binding protein-like 0.0000000113
Further Details:      
 
Domain Number 2 Region: 122-224
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000301
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HH65
Sequence length 342
Comment (tr|F7HH65|F7HH65_CALJA) Glutamate ionotropic receptor AMPA type subunit 4 {ECO:0000313|Ensembl:ENSCJAP00000018176} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GRIA4 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIW
NGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDP
LAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFS
LGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLA
KQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKF
AFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSL
Download sequence
Identical sequences F7HH65
ENSCJAP00000018176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]