SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HIL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HIL5
Domain Number 1 Region: 55-115
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 590-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 645-702
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-22
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 701-758
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 10 Region: 745-806
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 11 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 12 Region: 205-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 13 Region: 797-830
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000129
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HIL5
Sequence length 837
Comment (tr|F7HIL5|F7HIL5_MACMU) Zinc finger protein 546 {ECO:0000313|Ensembl:ENSMMUP00000022614} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ZNF546 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MQVDPPLHGPPNDLLIFQIIPLHSLSIMPRLLWILCFSMEEAQGELTSSCRSKTMADVSL
AFRDVSIDLSQEEWECLNPAQRDLYKDVMLENYSNLVSLGYTIPKPDVITLLEQQKEPWI
VMREGTRSWYTDLEYKYITTNLLSEKNVCKLYLSQLHTGEKSKNTIHEDTIFRNALQCKH
EFERQEGHQMGCVSQMIIQKQISHPLHLKIHAREKSYECKECRKAFRQQSYLIQHLRIHT
GERPHKCMECGKAFCRVGDLRVHQTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKP
YECKECGKAFSRVRDLRVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECK
VCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGK
SFSFHAELARHHRIHTGEKPYECKECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFIC
GYQLTLHLRTHTGEIPYECKECGKTFSSRYNLTQHYRIHTGEKPYICNECGKAFRLQAEL
TRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYVCKECGKIFSRRYNLTQHF
KIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHT
GEKPYECKECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGEIP
YECKECGKTFSRRYHLTQHFRLHTGEKPYSCKECGNAFRLQAELTRHHIVHTGEKPCKCK
ECGKAFSVNSELTRHHRIHTGEKPYKCKECGKAFIHSDQLTLHQRNHVSEEVLLCVM
Download sequence
Identical sequences F7HIL5
ENSMMUP00000022614 XP_014979410.1.72884 9544.ENSMMUP00000022614 ENSMMUP00000022614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]