SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HIT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HIT1
Domain Number 1 Region: 524-893
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.58e-128
Family Hect, E3 ligase catalytic domain 0.0000000038
Further Details:      
 
Domain Number 2 Region: 20-158
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.42e-29
Family Synaptotagmin-like (S variant) 0.05
Further Details:      
 
Domain Number 3 Region: 469-509
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000262
Family WW domain 0.00012
Further Details:      
 
Domain Number 4 Region: 182-225
Classification Level Classification E-value
Superfamily WW domain 0.000000000000181
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 342-382
Classification Level Classification E-value
Superfamily WW domain 0.000000000000487
Family WW domain 0.0018
Further Details:      
 
Domain Number 6 Region: 421-455
Classification Level Classification E-value
Superfamily WW domain 0.00000000000306
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HIT1
Sequence length 900
Comment (tr|F7HIT1|F7HIT1_MACMU) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=NEDD4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MATCAVEVFGLLEDEENSRIVRVKVIAGIGLAKKDILGASDPYVRVTLYDPVNGVLTSVQ
TKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRL
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDA
ACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQA
QRAFTTRRQISEETESVDNRESSENWEIIREDEATMYSSQAFPSPPPSSNLDVPTHLAEE
LNARLTIFGNSATSQSASSSNHSSRRGSLQAYTFEEQPALPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSSQQVTQPSEIEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSSDLGPLPPGWE
ERTHTDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIP
NKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEM
FNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPF
YKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGS
EIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGL
GDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAE
LYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
Download sequence
Identical sequences F7HIT1
XP_014997787.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]